PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10020263m
Common NameCICLE_v10020263mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 427aa    MW: 46471.4 Da    PI: 6.4603
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10020263mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.5e-10229287563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  Ciclev10020263m 229 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLTAEN 287
                      9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-16225289IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932227290IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-11229280No hitNo description
PfamPF001709.8E-9229283IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-10229283No hitNo description
CDDcd147031.84E-25230279No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MDKDKSLSHG GIPPPSGRYS SFSPPGNNNF NVKPELPSSS SFPPLAPGGS SSDGSHFGHQ  60
SDSNRFSHDL SRMHDNPPKN VGHRRAHSEI LTLPDDISFD SDLGVVGGAD GPSLSDETEE  120
DLLSMYLDMD KFNASTATSG FQVGEPSAAA APAPTSAVAA GSGISSVENV GVGSTERPRI  180
RHQHSQSMDG STSIKPEMLM SASDEAPSAD SKKAMSAAKL AELALIDPKR AKRIWANRQS  240
AARSKERKMR YIAELERKVQ TLQTEATSLS AQLTLLQRDT NGLTAENSEL KLRLQTMEQQ  300
VHLQDALNDA LKEEIQHLKV LTGQAMPNGG PMMNYPSFGA GQQFYPNNQA MHTLLTAQQF  360
QQLQIHSQKQ QQQFQQHQLH QMQQQQLQQQ QQEQQQQTGE IKMRGSVPSP NQKENASDVN  420
PSTSKD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.44890.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006442989.10.0hypothetical protein CICLE_v10020263mg
RefseqXP_006478733.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-160POF21_ARATH; Probable transcription factor PosF21
TrEMBLV4VSX80.0V4VSX8_9R
STRINGVIT_05s0102g01120.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-138bZIP family protein